SCOPe 2.04: Domain d2oypa_: 2oyp A:

Lineage for d2oypa_ (2oyp A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)

8. Domain d2oypa_: 2oyp A: [205400]
   automated match to d1py9a_
   complexed with so4

Details for d2oypa_

PDB Entry: 2oyp, 1.95 Å

PDB Description: t cell immunoglobulin mucin-3 crystal structure revealed a galectin-9- independent binding surface

PDB Compounds: (A:) Hepatitis A virus cellular receptor 2

SCOPe Domain Sequences for d2oypa_:

Sequence; same for both SEQRES and ATOM records:

>d2oypa_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mdgykvevgknaylpcsytlptsgtlvpmcwgkgfcpwsqctnellrtdernvtyqkssr
yqlkgdlnkgdvsliiknvtlddhgtyccriqfpglmndkklelkldik

Timeline for d2oypa_:

• d2oypa_ first appeared in SCOPe 2.03
  
• d2oypa_ appears in SCOPe 2.05
  
• d2oypa_ appears in the current release, SCOPe 2.08, called d2oypa1