SCOPe 2.06: Domain d1brec_: 1bre C:

Lineage for d1brec_ (1bre C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (19 PDB entries)

8. Domain d1brec_: 1bre C: [20540]
   VL dimer of Bence-Jones protein BRE

Details for d1brec_

PDB Entry: 1bre, 2 Å

PDB Description: immunoglobulin light chain protein

PDB Compounds: (C:) bence-jones kappa I protein bre

SCOPe Domain Sequences for d1brec_:

Sequence; same for both SEQRES and ATOM records:

>d1brec_ b.1.1.1 (C:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveik

Timeline for d1brec_:

• d1brec_ first appeared (with stable ids) in SCOP 1.55
  
• d1brec_ appears in SCOPe 2.05
  
• d1brec_ appears in SCOPe 2.07
  
• d1brec_ appears in the current release, SCOPe 2.08