Lineage for d1brec_ (1bre C:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 51873Species Bence-Jones VL (kappa) dimer BRE (human) [48924] (3 PDB entries)
  8. 51882Domain d1brec_: 1bre C: [20540]

Details for d1brec_

PDB Entry: 1bre (more details), 2 Å

PDB Description: immunoglobulin light chain protein

SCOP Domain Sequences for d1brec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1brec_ b.1.1.1 (C:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) dimer BRE (human)}
diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveik

SCOP Domain Coordinates for d1brec_:

Click to download the PDB-style file with coordinates for d1brec_.
(The format of our PDB-style files is described here.)

Timeline for d1brec_: