SCOPe 2.05: Domain d2ox4g2: 2ox4 G:119-392

Lineage for d2ox4g2 (2ox4 G:119-392)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (71 species)
   not a true protein

7. Species Zymomonas mobilis [TaxId:542] [225233] (1 PDB entry)

8. Domain d2ox4g2: 2ox4 G:119-392 [205391]
   Other proteins in same PDB: d2ox4a1, d2ox4b1, d2ox4c1, d2ox4d1, d2ox4e1, d2ox4f1, d2ox4g1, d2ox4h1
   automated match to d2gl5a1
   complexed with cl, gol, mg

Details for d2ox4g2

PDB Entry: 2ox4, 1.8 Å

PDB Description: crystal structure of putative dehydratase from zymomonas mobilis zm4

PDB Compounds: (G:) Putative mandelate racemase

SCOPe Domain Sequences for d2ox4g2:

Sequence; same for both SEQRES and ATOM records:

>d2ox4g2 c.1.11.0 (G:119-392) automated matches {Zymomonas mobilis [TaxId: 542]}
knredlrvyasqlqfgwgkerkskgrkeeyaeealkavaegydavkvdvlahdrngsreg
vflegplpsetikigverveairnavgpdvdiivenhghtdlvsaiqfakaieefniffy
eeintplnprllkeakkkidiplasgeriysrwgflpfledrsidviqpdlgtcggftef
kkiadmahifevtvqahvagtgvaeaaslhaeiaipnfcihehhqktllpeyeelcvhny
qpvkgrykvpelpgigqditeklyqisdyvsiea

Timeline for d2ox4g2:

• d2ox4g2 first appeared in SCOPe 2.03
  
• d2ox4g2 appears in SCOPe 2.04
  
• d2ox4g2 appears in SCOPe 2.06
  
• d2ox4g2 appears in the current release, SCOPe 2.08