Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
Species Bence-Jones VL (kappa) dimer BRE (human) [48924] (3 PDB entries) |
Domain d1breb_: 1bre B: [20539] |
PDB Entry: 1bre (more details), 2 Å
SCOP Domain Sequences for d1breb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1breb_ b.1.1.1 (B:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) dimer BRE (human)} diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveik
Timeline for d1breb_: