Lineage for d2ov3a_ (2ov3 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912348Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2912356Family c.92.2.2: TroA-like [53811] (6 proteins)
  6. 2912385Protein automated matches [191053] (5 species)
    not a true protein
  7. 2912421Species Synechocystis sp. [TaxId:1143] [225291] (2 PDB entries)
  8. 2912422Domain d2ov3a_: 2ov3 A: [205375]
    automated match to d1pq4a_
    complexed with zn; mutant

Details for d2ov3a_

PDB Entry: 2ov3 (more details), 2.4 Å

PDB Description: crystal structure of 138-173 znua deletion mutant plus zinc bound
PDB Compounds: (A:) periplasmic binding protein component of an ABC type zinc uptake transporter

SCOPe Domain Sequences for d2ov3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ov3a_ c.92.2.2 (A:) automated matches {Synechocystis sp. [TaxId: 1143]}
damditvsippqqyflekiggdlvrvsvlvpgnndphtyepkpqqlaalseaeayvligl
gfeqpwleklkaananmklidsaqgitplempgrlmvadphiwlsptlvkrqattiakel
aeldpdnrdqyeanlaaflaelerlnqelgqilqplpqrkfivfhpswayfardynlvqi
pievegqepsaqelkqlidtakennltmvfgetqfstksseaiaaeigagvelldplaad
wssnlkavaqkianansaqp

SCOPe Domain Coordinates for d2ov3a_:

Click to download the PDB-style file with coordinates for d2ov3a_.
(The format of our PDB-style files is described here.)

Timeline for d2ov3a_: