Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Geobacillus stearothermophilus [TaxId:1422] [188756] (8 PDB entries) |
Domain d2oukc1: 2ouk C:0-240 [205371] Other proteins in same PDB: d2ouka2, d2oukc2 automated match to d1b0ua_ complexed with so4 |
PDB Entry: 2ouk (more details), 2.15 Å
SCOPe Domain Sequences for d2oukc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oukc1 c.37.1.0 (C:0-240) automated matches {Geobacillus stearothermophilus [TaxId: 1422]} qmidvhqlkksfgslevlkginvhiregevvvvigpsgsgkstflrclnlledfdegeii idginlkakdtnlnkvreevgmvfqrfnlfphmtvlnnitlapmkvrkwprekaeakame lldkvglkdkahaypdslsggqaqrvaiaralamepkimlfdeptsaldpemvgevlsvm kqlanegmtmvvvthemgfarevgdrvlfmdggyiieegkpedlfdrpqhertkaflskv f
Timeline for d2oukc1:
View in 3D Domains from other chains: (mouse over for more information) d2ouka1, d2ouka2, d2oukb_, d2oukd_ |