Lineage for d1qp1c_ (1qp1 C:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7214Species Bence-Jones VL (kappa) dimer BRE (human) [48924] (3 PDB entries)
  8. 7220Domain d1qp1c_: 1qp1 C: [20537]

Details for d1qp1c_

PDB Entry: 1qp1 (more details), 2.06 Å

PDB Description: kappa variable light chain

SCOP Domain Sequences for d1qp1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qp1c_ b.1.1.1 (C:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) dimer BRE (human)}
diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveik

SCOP Domain Coordinates for d1qp1c_:

Click to download the PDB-style file with coordinates for d1qp1c_.
(The format of our PDB-style files is described here.)

Timeline for d1qp1c_: