SCOPe 2.06: Domain d2oqra2: 2oqr A:129-226

Lineage for d2oqra2 (2oqr A:129-226)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.0: automated matches [191513] (1 protein)
   not a true family

6. Protein automated matches [190858] (17 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [225356] (2 PDB entries)

8. Domain d2oqra2: 2oqr A:129-226 [205352]
   Other proteins in same PDB: d2oqra1, d2oqra3
   automated match to d1p2fa1
   complexed with act, bme, la

Details for d2oqra2

PDB Entry: 2oqr, 2.03 Å

PDB Description: the structure of the response regulator regx3 from mycobacterium tuberculosis

PDB Compounds: (A:) Sensory transduction protein regX3

SCOPe Domain Sequences for d2oqra2:

Sequence; same for both SEQRES and ATOM records:

>d2oqra2 a.4.6.0 (A:129-226) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
gvlesgpvrmdverhvvsvngdtitlplkefdlleylmrnsgrvltrgqlidrvwgadyv
gdtktldvhvkrlrskieadpanpvhlvtvrglgykle

Timeline for d2oqra2:

• d2oqra2 first appeared in SCOPe 2.03
  
• d2oqra2 appears in SCOPe 2.05
  
• d2oqra2 appears in SCOPe 2.07
  
• d2oqra2 appears in the current release, SCOPe 2.08