SCOPe 2.05: Domain d2oqra1: 2oqr A:1-128

Lineage for d2oqra1 (2oqr A:1-128)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (59 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [225355] (1 PDB entry)

8. Domain d2oqra1: 2oqr A:1-128 [205351]
   Other proteins in same PDB: d2oqra2
   automated match to d1p2fa2
   complexed with act, bme, la

Details for d2oqra1

PDB Entry: 2oqr, 2.03 Å

PDB Description: the structure of the response regulator regx3 from mycobacterium tuberculosis

PDB Compounds: (A:) Sensory transduction protein regX3

SCOPe Domain Sequences for d2oqra1:

Sequence; same for both SEQRES and ATOM records:

>d2oqra1 c.23.1.0 (A:1-128) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
atsvlivedeesladplafllrkegfeatvvtdgpaalaefdragadivlldlmlpgmsg
tdvckqlrarssvpvimvtardseidkvvglelgaddyvtkpysareliariravlrrgg
dddsemsd

Timeline for d2oqra1:

• d2oqra1 first appeared in SCOPe 2.03
  
• d2oqra1 appears in SCOPe 2.04
  
• d2oqra1 appears in SCOPe 2.06
  
• d2oqra1 appears in the current release, SCOPe 2.08