SCOP 1.67: Domain d1qp1a_: 1qp1 A:

Lineage for d1qp1a_ (1qp1 A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (19 PDB entries)

8. Domain d1qp1a_: 1qp1 A: [20535]

Details for d1qp1a_

PDB Entry: 1qp1, 2.06 Å

PDB Description: kappa variable light chain

SCOP Domain Sequences for d1qp1a_:

Sequence; same for both SEQRES and ATOM records:

>d1qp1a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1}
diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveik

Timeline for d1qp1a_:

• d1qp1a_ first appeared (with stable ids) in SCOP 1.55
  
• d1qp1a_ appears in SCOP 1.65
  
• d1qp1a_ appears in SCOP 1.69
  
• d1qp1a_ appears in the current release, SCOPe 2.08