SCOPe 2.05: Domain d2oo1c_: 2oo1 C:

Lineage for d2oo1c_ (2oo1 C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (258 PDB entries)

8. Domain d2oo1c_: 2oo1 C: [205345]
   automated match to d3jvma_
   complexed with 7pe, edo, na

Details for d2oo1c_

PDB Entry: 2oo1, 1.7 Å

PDB Description: crystal structure of the bromo domain 2 of human bromodomain containing protein 3 (brd3)

PDB Compounds: (C:) Bromodomain-containing protein 3

SCOPe Domain Sequences for d2oo1c_:

Sequence; same for both SEQRES and ATOM records:

>d2oo1c_ a.29.2.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klsehlrycdsilremlskkhaayawpfykpvdaealelhdyhdiikhpmdlstvkrkmd
greypdaqgfaadvrlmfsncykynppdhevvamarklqdvfemrfakmp

Timeline for d2oo1c_:

• d2oo1c_ first appeared in SCOPe 2.03
  
• d2oo1c_ appears in SCOPe 2.04
  
• d2oo1c_ appears in SCOPe 2.06
  
• d2oo1c_ appears in the current release, SCOPe 2.08