SCOP 1.59: Domain d1b0wc_: 1b0w C:

Lineage for d1b0wc_ (1b0w C:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Bence-Jones VL (kappa) dimer BRE (human) [48924] (3 PDB entries)

8. Domain d1b0wc_: 1b0w C: [20534]

Details for d1b0wc_

PDB Entry: 1b0w, 1.8 Å

PDB Description: structural comparison of amyloidogenic light chain dimer in two crystal forms with nonamyloidogenic counterparts

SCOP Domain Sequences for d1b0wc_:

Sequence; same for both SEQRES and ATOM records:

>d1b0wc_ b.1.1.1 (C:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) dimer BRE (human)}
diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveikr

Timeline for d1b0wc_:

• d1b0wc_ first appeared (with stable ids) in SCOP 1.55
  
• d1b0wc_ appears in SCOP 1.57
  
• d1b0wc_ appears in SCOP 1.61
  
• d1b0wc_ appears in the current release, SCOPe 2.08