SCOPe 2.06: Domain d2onhb1: 2onh B:57-271

Lineage for d2onhb1 (2onh B:57-271)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.0: automated matches [227201] (1 protein)
   not a true family

6. Protein automated matches [226931] (9 species)
   not a true protein

7. Species Mentha spicata [TaxId:29719] [225228] (2 PDB entries)

8. Domain d2onhb1: 2onh B:57-271 [205339]
   Other proteins in same PDB: d2onha2, d2onhb2
   automated match to d1n1ba1
   complexed with btb, f3p, mn

Details for d2onhb1

PDB Entry: 2onh, 2.7 Å

PDB Description: crystal structure of of limonene synthase with 2-fluorolinalyl diphosphate(flpp)

PDB Compounds: (B:) 4S-limonene synthase

SCOPe Domain Sequences for d2onhb1:

Sequence; same for both SEQRES and ATOM records:

>d2onhb1 a.102.4.0 (B:57-271) automated matches {Mentha spicata [TaxId: 29719]}
mrrsgnynpsrwdvnfiqsllsdykedkhviraselvtlvkmeleketdqirqleliddl
qrmglsdhfqnefkeilssiyldhhyyknpfpkeerdlystslafrllrehgfqvaqevf
dsfkneegefkeslsddtrgllqlyeasflltegettlesarefatkfleekvneggvdg
dlltriaysldiplhwrikrpnapvwiewyrkrpd

Timeline for d2onhb1:

• d2onhb1 first appeared in SCOPe 2.03
  
• d2onhb1 appears in SCOPe 2.05
  
• d2onhb1 appears in SCOPe 2.07
  
• d2onhb1 appears in the current release, SCOPe 2.08