Class a: All alpha proteins [46456] (289 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) |
Family a.102.4.0: automated matches [227201] (1 protein) not a true family |
Protein automated matches [226931] (9 species) not a true protein |
Species Mentha spicata [TaxId:29719] [225228] (2 PDB entries) |
Domain d2ongb1: 2ong B:57-271 [205335] Other proteins in same PDB: d2onga2, d2ongb2 automated match to d1n1ba1 complexed with btb, fpg, mn |
PDB Entry: 2ong (more details), 2.7 Å
SCOPe Domain Sequences for d2ongb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ongb1 a.102.4.0 (B:57-271) automated matches {Mentha spicata [TaxId: 29719]} mrrsgnynpsrwdvnfiqsllsdykedkhviraselvtlvkmeleketdqirqleliddl qrmglsdhfqnefkeilssiyldhhyyknpfpkeerdlystslafrllrehgfqvaqevf dsfkneegefkeslsddtrgllqlyeasflltegettlesarefatkfleekvneggvdg dlltriaysldiplhwrikrpnapvwiewyrkrpd
Timeline for d2ongb1: