SCOPe 2.01: Domain d1b0wb_: 1b0w B:

Lineage for d1b0wb_ (1b0w B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (18 PDB entries)

8. Domain d1b0wb_: 1b0w B: [20533]
   VL dimer of Bence-Jones protein BRE

Details for d1b0wb_

PDB Entry: 1b0w, 1.8 Å

PDB Description: structural comparison of amyloidogenic light chain dimer in two crystal forms with nonamyloidogenic counterparts

PDB Compounds: (B:) bence-jones kappa I protein bre

SCOPe Domain Sequences for d1b0wb_:

Sequence; same for both SEQRES and ATOM records:

>d1b0wb_ b.1.1.1 (B:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveikr

Timeline for d1b0wb_:

• d1b0wb_ first appeared (with stable ids) in SCOP 1.55
  
• d1b0wb_ appears in SCOP 1.75
  
• d1b0wb_ appears in SCOPe 2.02
  
• d1b0wb_ appears in the current release, SCOPe 2.08