Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (73 species) not a true protein |
Species Necator americanus [TaxId:51031] [224849] (6 PDB entries) |
Domain d2on7a2: 2on7 A:78-206 [205325] Other proteins in same PDB: d2on7a1, d2on7b1, d2on7c1, d2on7d1 automated match to d1tw9a1 |
PDB Entry: 2on7 (more details), 2.4 Å
SCOPe Domain Sequences for d2on7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2on7a2 a.45.1.0 (A:78-206) automated matches {Necator americanus [TaxId: 51031]} agkstfdeavvdsladqysdyrveiksffytvigmregdveqlkkevllpardkffgfit kflkkspsgflvgdsltwvdllvsehnatmltfvpeflegypevkehmekiraipklkkw ietrpetlf
Timeline for d2on7a2: