SCOP 1.57: Domain d1wtlb_: 1wtl B:

Lineage for d1wtlb_ (1wtl B:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Bence-Jones VL (kappa) dimer WAT (human) [48923] (1 PDB entry)

8. Domain d1wtlb_: 1wtl B: [20531]

Details for d1wtlb_

PDB Entry: 1wtl, 1.9 Å

PDB Description: comparison of crystal structures of two homologous proteins: structural origin of altered domain interactions in immunoglobulin light chain dimers

SCOP Domain Sequences for d1wtlb_:

Sequence; same for both SEQRES and ATOM records:

>d1wtlb_ b.1.1.1 (B:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) dimer WAT (human)}
diqmtqspsslsasvgdrvtitcrasqditnyvnwfqqrpgqapkvliygasiletgvps
rfsgsgsgtdftftisslqpediatyycqqydtlpltfgggtkvdikr

Timeline for d1wtlb_:

• d1wtlb_ first appeared (with stable ids) in SCOP 1.55
  
• d1wtlb_ appears in SCOP 1.59
  
• d1wtlb_ appears in the current release, SCOPe 2.08