Lineage for d1wtlb_ (1wtl B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) 
Species Bence-Jones VL (kappa) dimer WAT (human) [48923] (1 PDB entry) 
Domain d1wtlb_: 1wtl B: [20531]
Details for d1wtlb_
PDB Entry: 1wtl (more details), 1.9 Å
PDB Description: comparison of crystal structures of two homologous proteins: structural origin of altered domain interactions in immunoglobulin light chain dimers
SCOP Domain Sequences for d1wtlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wtlb_ b.1.1.1 (B:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) dimer WAT (human)}
diqmtqspsslsasvgdrvtitcrasqditnyvnwfqqrpgqapkvliygasiletgvps
rfsgsgsgtdftftisslqpediatyycqqydtlpltfgggtkvdikr
SCOP Domain Coordinates for d1wtlb_:
Click to download the PDB-style file with coordinates for d1wtlb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wtlb_:
- d1wtlb_ appears in SCOP 1.57
- d1wtlb_ appears in the current release, SCOPe 2.08
View in 3D
