Lineage for d1wtla_ (1wtl A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7233Species Bence-Jones VL (kappa) dimer WAT (human) [48923] (1 PDB entry)
  8. 7234Domain d1wtla_: 1wtl A: [20530]

Details for d1wtla_

PDB Entry: 1wtl (more details), 1.9 Å

PDB Description: comparison of crystal structures of two homologous proteins: structural origin of altered domain interactions in immunoglobulin light chain dimers

SCOP Domain Sequences for d1wtla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wtla_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) dimer WAT (human)}
diqmtqspsslsasvgdrvtitcrasqditnyvnwfqqrpgqapkvliygasiletgvps
rfsgsgsgtdftftisslqpediatyycqqydtlpltfgggtkvdikr

SCOP Domain Coordinates for d1wtla_:

Click to download the PDB-style file with coordinates for d1wtla_.
(The format of our PDB-style files is described here.)

Timeline for d1wtla_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wtlb_