SCOPe 2.08: Domain d2ombb1: 2omb B:1-112

Lineage for d2ombb1 (2omb B:1-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d2ombb1: 2omb B:1-112 [205296]
   Other proteins in same PDB: d2omba2, d2ombb2, d2ombc2, d2ombd2
   automated match to d1aqkl1
   complexed with iph, so4

Details for d2ombb1

PDB Entry: 2omb, 2.9 Å

PDB Description: bence jones kwr protein- immunoglobulin light chain dimer, p3(1)21 crystal form

PDB Compounds: (B:) Bence Jones KWR Protein - Immunoglobulin Light Chain

SCOPe Domain Sequences for d2ombb1:

Sequence; same for both SEQRES and ATOM records:

>d2ombb1 b.1.1.0 (B:1-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esalpqpasvsgspgqsitisctgtssdvggydlvswyqhhpggapkliiyevtnrpsgv
sdrfsgsksgntasltisglqaedeadyycssyasgstprifgggtrltvlg

Timeline for d2ombb1:

• d2ombb1 first appeared in SCOPe 2.03
  
• d2ombb1 appears in SCOPe 2.07