SCOPe 2.03: Domain d2olkb_: 2olk B:

Lineage for d2olkb_ (2olk B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (58 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [188756] (6 PDB entries)

8. Domain d2olkb_: 2olk B: [205289]
   automated match to d1b0ua_
   complexed with at4

Details for d2olkb_

PDB Entry: 2olk, 2.1 Å

PDB Description: abc protein artp in complex with adp-beta-s

PDB Compounds: (B:) Amino acid ABC transporter

SCOPe Domain Sequences for d2olkb_:

Sequence; same for both SEQRES and ATOM records:

>d2olkb_ c.37.1.0 (B:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
lqmidvhqlkksfgslevlkginvhiregevvvvigpsgsgkstflrclnlledfdegei
iidginlkakdtnlnkvreevgmvfqrfnlfphmtvlnnitlapmkvrkwprekaeakam
elldkvglkdkahaypdslsggqaqrvaiaralamepkimlfdeptsaldpemvgevlsv
mkqlanegmtmvvvthemgfarevgdrvlfmdggyiieegkpedlfdrpqhertkaflsk
vf

Timeline for d2olkb_:

• d2olkb_ is new in SCOPe 2.03-stable
  
• d2olkb_ appears in SCOPe 2.04
  
• d2olkb_ appears in the current release, SCOPe 2.08, called d2olkb1