SCOPe 2.07: Domain d4bjla1: 4bjl A:2-111

Lineage for d4bjla1 (4bjl A:2-111)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Human (Homo sapiens), cluster 2 [TaxId:9606] [88536] (10 PDB entries)

8. Domain d4bjla1: 4bjl A:2-111 [20528]
   Other proteins in same PDB: d4bjla2, d4bjlb2
   VL dimer of Bence-Jones protein LOC

Details for d4bjla1

PDB Entry: 4bjl, 2.4 Å

PDB Description: locw, a lambda 1 type light-chain dimer (bence-jones protein) crystallized in distilled water

PDB Compounds: (A:) loc - lambda 1 type light-chain dimer

SCOPe Domain Sequences for d4bjla1:

Sequence; same for both SEQRES and ATOM records:

>d4bjla1 b.1.1.1 (A:2-111) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]}
svltqppsasgtpgqrvtiscsgsssnigensvtwyqhlsgtapklliyednsrasgvsd
rfsasksgtsaslaisglqpedetdyycaawddsldvavfgtgtkvtvlg

Timeline for d4bjla1:

• d4bjla1 first appeared (with stable ids) in SCOP 1.55
  
• d4bjla1 appears in SCOPe 2.06
  
• d4bjla1 appears in the current release, SCOPe 2.08