SCOP 1.63: Domain d4bjla1: 4bjl A:1-111

Lineage for d4bjla1 (4bjl A:1-111)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Bence-Jones lambda L chain dimer LOC (human) [48922] (3 PDB entries)

8. Domain d4bjla1: 4bjl A:1-111 [20528]
   Other proteins in same PDB: d4bjla2, d4bjlb2

Details for d4bjla1

PDB Entry: 4bjl, 2.4 Å

PDB Description: locw, a lambda 1 type light-chain dimer (bence-jones protein) crystallized in distilled water

SCOP Domain Sequences for d4bjla1:

Sequence; same for both SEQRES and ATOM records:

>d4bjla1 b.1.1.1 (A:1-111) Immunoglobulin (variable domains of L and H chains) {Bence-Jones lambda L chain dimer LOC (human)}
esvltqppsasgtpgqrvtiscsgsssnigensvtwyqhlsgtapklliyednsrasgvs
drfsasksgtsaslaisglqpedetdyycaawddsldvavfgtgtkvtvlg

Timeline for d4bjla1:

• d4bjla1 first appeared (with stable ids) in SCOP 1.55
  
• d4bjla1 appears in SCOP 1.61
  
• d4bjla1 appears in SCOP 1.65
  
• d4bjla1 appears in the current release, SCOPe 2.08