Lineage for d4bjla1 (4bjl A:1-111)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7207Species Bence-Jones lambda L chain dimer LOC (human) [48922] (3 PDB entries)
  8. 7212Domain d4bjla1: 4bjl A:1-111 [20528]
    Other proteins in same PDB: d4bjla2, d4bjlb2

Details for d4bjla1

PDB Entry: 4bjl (more details), 2.4 Å

PDB Description: locw, a lambda 1 type light-chain dimer (bence-jones protein) crystallized in distilled water

SCOP Domain Sequences for d4bjla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bjla1 b.1.1.1 (A:1-111) Immunoglobulin (variable domains of L and H chains) {Bence-Jones lambda L chain dimer LOC (human)}
esvltqppsasgtpgqrvtiscsgsssnigensvtwyqhlsgtapklliyednsrasgvs
drfsasksgtsaslaisglqpedetdyycaawddsldvavfgtgtkvtvlg

SCOP Domain Coordinates for d4bjla1:

Click to download the PDB-style file with coordinates for d4bjla1.
(The format of our PDB-style files is described here.)

Timeline for d4bjla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bjla2