Lineage for d2ohfa2 (2ohf A:305-388)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1895126Superfamily d.15.10: TGS-like [81271] (3 families) (S)
    possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif
  5. 1895150Family d.15.10.0: automated matches [227173] (1 protein)
    not a true family
  6. 1895151Protein automated matches [226888] (2 species)
    not a true protein
  7. 1895152Species Human (Homo sapiens) [TaxId:9606] [225258] (1 PDB entry)
  8. 1895153Domain d2ohfa2: 2ohf A:305-388 [205273]
    Other proteins in same PDB: d2ohfa1
    automated match to d1ni3a2
    complexed with acp

Details for d2ohfa2

PDB Entry: 2ohf (more details), 2.7 Å

PDB Description: crystal structure of human ola1 in complex with amppcp
PDB Compounds: (A:) GTP-binding protein 9

SCOPe Domain Sequences for d2ohfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ohfa2 d.15.10.0 (A:305-388) automated matches {Human (Homo sapiens) [TaxId: 9606]}
leyfftagpdevrawtirkgtkapqaagkihtdfekgfimaevmkyedfkeegsenavka
agkyrqqgrnyivedgdiiffkfn

SCOPe Domain Coordinates for d2ohfa2:

Click to download the PDB-style file with coordinates for d2ohfa2.
(The format of our PDB-style files is described here.)

Timeline for d2ohfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ohfa1