SCOP 1.55: Domain d3bjlb1: 3bjl B:1-111

Lineage for d3bjlb1 (3bjl B:1-111)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Bence-Jones lambda L chain dimer LOC (human) [48922] (3 PDB entries)

8. Domain d3bjlb1: 3bjl B:1-111 [20527]
   Other proteins in same PDB: d3bjla2, d3bjlb2

Details for d3bjlb1

PDB Entry: 3bjl, 2.3 Å

PDB Description: loc, a lambda 1 type light-chain dimer (bence-jones protein) crystallized in ammonium sulfate

SCOP Domain Sequences for d3bjlb1:

Sequence; same for both SEQRES and ATOM records:

>d3bjlb1 b.1.1.1 (B:1-111) Immunoglobulin (variable domains of L and H chains) {Bence-Jones lambda L chain dimer LOC (human)}
esvltqppsasgtpgqrvtiscsgsssnigensvtwyqhlsgtapklliyednsrasgvs
drfsasksgtsaslaisglqpedetdyycaawddsldvavfgtgtkvtvlg

Timeline for d3bjlb1:

• d3bjlb1 appears in SCOP 1.57
  
• d3bjlb1 appears in the current release, SCOPe 2.08