Lineage for d3bjla1 (3bjl A:1-111)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 51866Species Bence-Jones lambda L chain dimer LOC (human) [48922] (3 PDB entries)
  8. 51869Domain d3bjla1: 3bjl A:1-111 [20526]
    Other proteins in same PDB: d3bjla2, d3bjlb2

Details for d3bjla1

PDB Entry: 3bjl (more details), 2.3 Å

PDB Description: loc, a lambda 1 type light-chain dimer (bence-jones protein) crystallized in ammonium sulfate

SCOP Domain Sequences for d3bjla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bjla1 b.1.1.1 (A:1-111) Immunoglobulin (variable domains of L and H chains) {Bence-Jones lambda L chain dimer LOC (human)}
esvltqppsasgtpgqrvtiscsgsssnigensvtwyqhlsgtapklliyednsrasgvs
drfsasksgtsaslaisglqpedetdyycaawddsldvavfgtgtkvtvlg

SCOP Domain Coordinates for d3bjla1:

Click to download the PDB-style file with coordinates for d3bjla1.
(The format of our PDB-style files is described here.)

Timeline for d3bjla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bjla2