Lineage for d2ofwa_ (2ofw A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128604Species Human (Homo sapiens) [TaxId:9606] [186862] (124 PDB entries)
  8. 2128687Domain d2ofwa_: 2ofw A: [205256]
    automated match to d1m7gc_
    complexed with adx, mg

Details for d2ofwa_

PDB Entry: 2ofw (more details), 2.05 Å

PDB Description: crystal structure of the apsk domain of human papss1 complexed with 2 aps molecules
PDB Compounds: (A:) APS kinase domain of the PAPS synthetase 1

SCOPe Domain Sequences for d2ofwa_:

Sequence, based on SEQRES records: (download)

>d2ofwa_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nvtyqahhvsrnkrgqvvgtrggfrgctiwltglsgagkttvsmaleeylvchgipcytl
dgdnirqglnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnnarqih
egaslpffevfvdaplhvceqrdvkglykkarageikgftgidseyekpeapelvlktds
cdvndcvqqvvellnerdilp

Sequence, based on observed residues (ATOM records): (download)

>d2ofwa_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nvtyqahhvsrnkrgqvvgtrggfrgctiwltglsgagkttvsmaleeylvchgipcytl
dgdnirqglnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnnarqih
egaslpffevfvdaplhvceqrdkglykkarageikgftgidseyekpeapelvlktdsc
dvndcvqqvvellnerdilp

SCOPe Domain Coordinates for d2ofwa_:

Click to download the PDB-style file with coordinates for d2ofwa_.
(The format of our PDB-style files is described here.)

Timeline for d2ofwa_: