Lineage for d1bjma1 (1bjm A:1-111)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 157655Species Bence-Jones lambda L chain dimer LOC (human) [48922] (3 PDB entries)
  8. 157656Domain d1bjma1: 1bjm A:1-111 [20524]
    Other proteins in same PDB: d1bjma2, d1bjmb2

Details for d1bjma1

PDB Entry: 1bjm (more details), 2.2 Å

PDB Description: loc naks, a lambda 1 type light-chain dimer (bence-jones protein) crystallized in nakso4

SCOP Domain Sequences for d1bjma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bjma1 b.1.1.1 (A:1-111) Immunoglobulin (variable domains of L and H chains) {Bence-Jones lambda L chain dimer LOC (human)}
esvltqppsasgtpgqrvtiscsgsssnigensvtwyqhlsgtapklliyednsrasgvs
drfsasksgtsaslaisglqpedetdyycaawddsldvavfgtgtkvtvlg

SCOP Domain Coordinates for d1bjma1:

Click to download the PDB-style file with coordinates for d1bjma1.
(The format of our PDB-style files is described here.)

Timeline for d1bjma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bjma2