SCOPe 2.08: Domain d2o5zl1: 2o5z L:1-107

Lineage for d2o5zl1 (2o5z L:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d2o5zl1: 2o5z L:1-107 [205233]
   Other proteins in same PDB: d2o5zl2
   automated match to d1t66c1
   complexed with ano, so4

Details for d2o5zl1

PDB Entry: 2o5z, 2.4 Å

PDB Description: Crystal structure of the 1E9 LeuH47Trp/ArgH100Trp Fab 5-beta-androstane-3,17-dione complex

PDB Compounds: (L:) chimeric antibody Fab 1E9-DB3

SCOPe Domain Sequences for d2o5zl1:

Sequence; same for both SEQRES and ATOM records:

>d2o5zl1 b.1.1.1 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspkfliykvsnrf
sgvpdrfsgsgsgtdfilkisrveaedlgvyfcfqsthffptfgggtkleik

Timeline for d2o5zl1:

• d2o5zl1 first appeared in SCOPe 2.03
  
• d2o5zl1 appears in SCOPe 2.07