Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
Species Bence-Jones VL (lambda) dimer RHE (human) [48921] (1 PDB entry) |
Domain d2rhe__: 2rhe - [20523] |
PDB Entry: 2rhe (more details), 1.6 Å
SCOP Domain Sequences for d2rhe__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rhe__ b.1.1.1 (-) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (lambda) dimer RHE (human)} esvltqppsasgtpgqrvtisctgsatdigsnsviwyqqvpgkapklliyyndllpsgvs drfsasksgtsaslaisglesedeadyycaawndsldepgfgggtkltvlgqpk
Timeline for d2rhe__: