Lineage for d2rhe__ (2rhe -)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102254Species Bence-Jones VL (lambda) dimer RHE (human) [48921] (1 PDB entry)
  8. 102255Domain d2rhe__: 2rhe - [20523]

Details for d2rhe__

PDB Entry: 2rhe (more details), 1.6 Å

PDB Description: structure of a novel bence-jones protein (rhe) fragment at 1.6 angstroms resolution

SCOP Domain Sequences for d2rhe__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rhe__ b.1.1.1 (-) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (lambda) dimer RHE (human)}
esvltqppsasgtpgqrvtisctgsatdigsnsviwyqqvpgkapklliyyndllpsgvs
drfsasksgtsaslaisglesedeadyycaawndsldepgfgggtkltvlgqpk

SCOP Domain Coordinates for d2rhe__:

Click to download the PDB-style file with coordinates for d2rhe__.
(The format of our PDB-style files is described here.)

Timeline for d2rhe__: