SCOPe 2.04: Domain d2o5ra2: 2o5r A:313-468

Lineage for d2o5ra2 (2o5r A:313-468)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.97: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48162] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.97.1: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48163] (3 families)

5. Family a.97.1.0: automated matches [227179] (1 protein)
   not a true family

6. Protein automated matches [226898] (4 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [225199] (2 PDB entries)

8. Domain d2o5ra2: 2o5r A:313-468 [205228]
   Other proteins in same PDB: d2o5ra1
   automated match to d1j09a1
   complexed with cl, gol

Details for d2o5ra2

PDB Entry: 2o5r, 2.34 Å

PDB Description: crystal structure of glutamyl-trna synthetase 1 (ec 6.1.1.17) (glutamate-trna ligase 1) (glurs 1) (tm1351) from thermotoga maritima at 2.5 a resolution

PDB Compounds: (A:) Glutamyl-tRNA synthetase 1

SCOPe Domain Sequences for d2o5ra2:

Sequence; same for both SEQRES and ATOM records:

>d2o5ra2 a.97.1.0 (A:313-468) automated matches {Thermotoga maritima [TaxId: 2336]}
dpqklkwmngyylrnmpieklaelakpffekagikiideeyfkkvleitkervevlsefp
eesrfffedpapveipeemkevfsqlkeelqnvrwtmeeitpvfkkvlkqhgvkpkefym
tlrrvltgreegpelvniipllgkeiflrrierslg

Timeline for d2o5ra2:

• d2o5ra2 first appeared in SCOPe 2.03
  
• d2o5ra2 appears in SCOPe 2.05
  
• d2o5ra2 appears in the current release, SCOPe 2.08