Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (59 species) not a true protein |
Species Thermotoga maritima [TaxId:2336] [225198] (2 PDB entries) |
Domain d2o5ra1: 2o5r A:1-312 [205227] Other proteins in same PDB: d2o5ra2 automated match to d1glna2 complexed with cl, gol |
PDB Entry: 2o5r (more details), 2.34 Å
SCOPe Domain Sequences for d2o5ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o5ra1 c.26.1.0 (A:1-312) automated matches {Thermotoga maritima [TaxId: 2336]} mvrvrfapsptgflhvggartalfnflfarkekgkfilriedtdlersereyeeklmesl rwlgllwdegpdvggdhgpyrqserveiyrehaerlvkegkayyvyaypeeieemrekll segkaphysqemfekfdtperrreyeekglrpavffkmprkdyvlndvvkgevvfktgai gdfvimrsnglptynfacvvddmlmeithvirgddhlsntlrqlalyeafekappvfahv stilgpdgkklskrhgatsveafrdmgylpealvnylallgwshpegkelltleelissf sldrlspnpaif
Timeline for d2o5ra1: