Lineage for d2o5ra1 (2o5r A:1-312)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1359291Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1359292Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1359851Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 1359852Protein automated matches [190459] (31 species)
    not a true protein
  7. 1359990Species Thermotoga maritima [TaxId:2336] [225198] (2 PDB entries)
  8. 1359992Domain d2o5ra1: 2o5r A:1-312 [205227]
    Other proteins in same PDB: d2o5ra2
    automated match to d1glna2
    complexed with cl, gol

Details for d2o5ra1

PDB Entry: 2o5r (more details), 2.34 Å

PDB Description: crystal structure of glutamyl-trna synthetase 1 (ec 6.1.1.17) (glutamate-trna ligase 1) (glurs 1) (tm1351) from thermotoga maritima at 2.5 a resolution
PDB Compounds: (A:) Glutamyl-tRNA synthetase 1

SCOPe Domain Sequences for d2o5ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o5ra1 c.26.1.0 (A:1-312) automated matches {Thermotoga maritima [TaxId: 2336]}
mvrvrfapsptgflhvggartalfnflfarkekgkfilriedtdlersereyeeklmesl
rwlgllwdegpdvggdhgpyrqserveiyrehaerlvkegkayyvyaypeeieemrekll
segkaphysqemfekfdtperrreyeekglrpavffkmprkdyvlndvvkgevvfktgai
gdfvimrsnglptynfacvvddmlmeithvirgddhlsntlrqlalyeafekappvfahv
stilgpdgkklskrhgatsveafrdmgylpealvnylallgwshpegkelltleelissf
sldrlspnpaif

SCOPe Domain Coordinates for d2o5ra1:

Click to download the PDB-style file with coordinates for d2o5ra1.
(The format of our PDB-style files is described here.)

Timeline for d2o5ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2o5ra2