SCOPe 2.01: Domain d1ar2a_: 1ar2 A:

Lineage for d1ar2a_ (1ar2 A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (18 PDB entries)

8. Domain d1ar2a_: 1ar2 A: [20522]
   VL of Bence-Jones protein REI; disulfide-free mutant

Details for d1ar2a_

PDB Entry: 1ar2, 2.8 Å

PDB Description: disulfide-free immunoglobulin fragment

PDB Compounds: (A:) rei

SCOPe Domain Sequences for d1ar2a_:

Sequence; same for both SEQRES and ATOM records:

>d1ar2a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
tpdiqmtqspsslsasvgdrvtitvqasqdiikhlnwyqqtpgkapklliyeasnlqagv
psrfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit

Timeline for d1ar2a_:

• d1ar2a_ first appeared (with stable ids) in SCOP 1.55, called d1ar2__
  
• d1ar2a_ appears in SCOP 1.75
  
• d1ar2a_ appears in SCOPe 2.02
  
• d1ar2a_ appears in the current release, SCOPe 2.08