Lineage for d1ar2__ (1ar2 -)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287738Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287780Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (16 PDB entries)
  8. 287812Domain d1ar2__: 1ar2 - [20522]
    VL of Bence-Jones protein REI; disulfide-free mutant

Details for d1ar2__

PDB Entry: 1ar2 (more details), 2.8 Å

PDB Description: disulfide-free immunoglobulin fragment

SCOP Domain Sequences for d1ar2__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ar2__ b.1.1.1 (-) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1}
tpdiqmtqspsslsasvgdrvtitvqasqdiikhlnwyqqtpgkapklliyeasnlqagv
psrfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit

SCOP Domain Coordinates for d1ar2__:

Click to download the PDB-style file with coordinates for d1ar2__.
(The format of our PDB-style files is described here.)

Timeline for d1ar2__: