Lineage for d1ar2__ (1ar2 -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7227Species Bence-Jones VL (kappa) dimer REI (human) [48920] (3 PDB entries)
  8. 7232Domain d1ar2__: 1ar2 - [20522]

Details for d1ar2__

PDB Entry: 1ar2 (more details), 2.8 Å

PDB Description: disulfide-free immunoglobulin fragment

SCOP Domain Sequences for d1ar2__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ar2__ b.1.1.1 (-) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) dimer REI (human)}
tpdiqmtqspsslsasvgdrvtitvqasqdiikhlnwyqqtpgkapklliyeasnlqagv
psrfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit

SCOP Domain Coordinates for d1ar2__:

Click to download the PDB-style file with coordinates for d1ar2__.
(The format of our PDB-style files is described here.)

Timeline for d1ar2__: