SCOP 1.59: Domain d1reib_: 1rei B:

Lineage for d1reib_ (1rei B:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Bence-Jones VL (kappa) dimer REI (human) [48920] (3 PDB entries)

8. Domain d1reib_: 1rei B: [20521]

Details for d1reib_

PDB Entry: 1rei, 2 Å

PDB Description: the molecular structure of a dimer composed of the variable portions of the bence-jones protein rei refined at 2.0 angstroms resolution

SCOP Domain Sequences for d1reib_:

Sequence; same for both SEQRES and ATOM records:

>d1reib_ b.1.1.1 (B:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) dimer REI (human)}
diqmtqspsslsasvgdrvtitcqasqdiikylnwyqqtpgkapklliyeasnlqagvps
rfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit

Timeline for d1reib_:

• d1reib_ first appeared (with stable ids) in SCOP 1.55
  
• d1reib_ appears in SCOP 1.57
  
• d1reib_ appears in SCOP 1.61
  
• d1reib_ appears in the current release, SCOPe 2.08