Lineage for d2o52a_ (2o52 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868094Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)
  8. 2868511Domain d2o52a_: 2o52 A: [205209]
    automated match to d2bmda1
    complexed with bme, gdp, mg, unx

Details for d2o52a_

PDB Entry: 2o52 (more details), 2.2 Å

PDB Description: crystal structure of human rab4b in complex with gdp
PDB Compounds: (A:) Ras-related protein Rab-4B

SCOPe Domain Sequences for d2o52a_:

Sequence, based on SEQRES records: (download)

>d2o52a_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdflfkflvigsagtgkscllhqfienkfkqdsnhtigvefgsrvvnvggktvklqiwdt
agqerfrsvtrsyyrgaagallvyditsretynslaawltdartlaspnivvilcgnkkd
ldperevtfleasrfaqenelmfletsaltgenveeaflkcartilnkidsgeldperm

Sequence, based on observed residues (ATOM records): (download)

>d2o52a_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdflfkflvigsagtgkscllhqfievefgsrvvnvggktvklqiwdtagqerfrsvtrs
yyrgaagallvyditsretynslaawltdartlaspnivvilcgnkkdldperevtflea
srfaqenelmfletsaltgenveeaflkcartilnkidsgeldperm

SCOPe Domain Coordinates for d2o52a_:

Click to download the PDB-style file with coordinates for d2o52a_.
(The format of our PDB-style files is described here.)

Timeline for d2o52a_: