SCOPe 2.03: Domain d1bwwb_: 1bww B:

Lineage for d1bwwb_ (1bww B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (19 PDB entries)

8. Domain d1bwwb_: 1bww B: [20519]
   VL dimer of Bence-Jones protein REI
   mutant

Details for d1bwwb_

PDB Entry: 1bww, 1.7 Å

PDB Description: bence-jones immunoglobulin rei variable portion, t39k mutant

PDB Compounds: (B:) protein (ig kappa chain v-I region rei)

SCOPe Domain Sequences for d1bwwb_:

Sequence; same for both SEQRES and ATOM records:

>d1bwwb_ b.1.1.1 (B:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
tpdiqmtqspsslsasvgdrvtitcqasqdiikylnwyqqkpgkapklliyeasnlqagv
psrfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit

Timeline for d1bwwb_:

• d1bwwb_ first appeared (with stable ids) in SCOP 1.55
  
• d1bwwb_ appears in SCOPe 2.02
  
• d1bwwb_ appears in SCOPe 2.04
  
• d1bwwb_ appears in the current release, SCOPe 2.08