Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
Species Bence-Jones VL (kappa) dimer REI (human) [48920] (3 PDB entries) |
Domain d1bwwb_: 1bww B: [20519] |
PDB Entry: 1bww (more details), 1.7 Å
SCOP Domain Sequences for d1bwwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bwwb_ b.1.1.1 (B:) Immunoglobulin (variable domains of L and H chains) {Bence-Jones VL (kappa) dimer REI (human)} tpdiqmtqspsslsasvgdrvtitcqasqdiikylnwyqqkpgkapklliyeasnlqagv psrfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit
Timeline for d1bwwb_: