![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
![]() | Protein automated matches [226944] (2 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:93062] [225287] (3 PDB entries) |
![]() | Domain d2nttb2: 2ntt B:87-216 [205181] Other proteins in same PDB: d2ntta1, d2ntta3, d2nttb1, d2nttb3 automated match to d2g9hd2 complexed with cl, edo |
PDB Entry: 2ntt (more details), 1.56 Å
SCOPe Domain Sequences for d2nttb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nttb2 d.15.6.1 (B:87-216) automated matches {Staphylococcus aureus [TaxId: 93062]} eyldksrnipiniwingnhktistnkvstnkkfvtaqeidvklrkylqeeyniyghngtk kgeeyghkskfysgfnigkvtfhlnnndtfsydlfytgddglpksflkiyednktvesek fhldvdisyk
Timeline for d2nttb2: