SCOP 1.71: Domain d1bwwa_: 1bww A:

Lineage for d1bwwa_ (1bww A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (18 PDB entries)

8. Domain d1bwwa_: 1bww A: [20518]

Details for d1bwwa_

PDB Entry: 1bww, 1.7 Å

PDB Description: bence-jones immunoglobulin rei variable portion, t39k mutant

SCOP Domain Sequences for d1bwwa_:

Sequence; same for both SEQRES and ATOM records:

>d1bwwa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1}
tpdiqmtqspsslsasvgdrvtitcqasqdiikylnwyqqkpgkapklliyeasnlqagv
psrfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit

Timeline for d1bwwa_:

• d1bwwa_ first appeared (with stable ids) in SCOP 1.55
  
• d1bwwa_ appears in SCOP 1.69
  
• d1bwwa_ appears in SCOP 1.73
  
• d1bwwa_ appears in the current release, SCOPe 2.08