SCOPe 2.05: Domain d2ntta1: 2ntt A:1-86

Lineage for d2ntta1 (2ntt A:1-86)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.0: automated matches [227133] (1 protein)
   not a true family

6. Protein automated matches [226834] (5 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [225286] (3 PDB entries)

8. Domain d2ntta1: 2ntt A:1-86 [205178]
   Other proteins in same PDB: d2ntta2, d2nttb2
   automated match to d2g9hd1
   complexed with cl, edo

Details for d2ntta1

PDB Entry: 2ntt, 1.56 Å

PDB Description: Crystal Structure of SEK

PDB Compounds: (A:) Staphylococcal enterotoxin K

SCOPe Domain Sequences for d2ntta1:

Sequence; same for both SEQRES and ATOM records:

>d2ntta1 b.40.2.0 (A:1-86) automated matches {Staphylococcus aureus [TaxId: 93062]}
qgdigidnlrnfytkkdfvdlkdvkdndtpianqlqfsnesydliseskdfnkfsnfkgk
kldvfgisyngqsntkyiyggvtatn

Timeline for d2ntta1:

• d2ntta1 first appeared in SCOPe 2.03
  
• d2ntta1 appears in SCOPe 2.04
  
• d2ntta1 appears in SCOPe 2.06
  
• d2ntta1 appears in the current release, SCOPe 2.08