Lineage for d2nsqa_ (2nsq A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2045100Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2045101Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2045347Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 2045348Protein automated matches [190497] (4 species)
    not a true protein
  7. 2045351Species Human (Homo sapiens) [TaxId:9606] [188711] (22 PDB entries)
  8. 2045355Domain d2nsqa_: 2nsq A: [205155]
    automated match to d3kwta_
    complexed with edo, gol

Details for d2nsqa_

PDB Entry: 2nsq (more details), 1.85 Å

PDB Description: Crystal structure of the C2 domain of the human E3 ubiquitin-protein ligase NEDD4-like protein
PDB Compounds: (A:) E3 ubiquitin-protein ligase NEDD4-like protein

SCOPe Domain Sequences for d2nsqa_:

Sequence, based on SEQRES records: (download)

>d2nsqa_ b.7.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gepvyglsedegesrilrvkvvsgidlakkdifgasdpyvklslyvadenrelalvqtkt
ikktlnpkwneefyfrvnpsnhrllfevfdenrltrddflgqvdvplshlptedptmerp
ytfkdfllrprshksrvkgflrlkmaymp

Sequence, based on observed residues (ATOM records): (download)

>d2nsqa_ b.7.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gepvyglsedegesrilrvkvvsgidlakkasdpyvklslyvadenrelalvqtktikkt
lnpkwneefyfrvnpsnhrllfevfdenrltrddflgqvdvplshlptedpytfkdfllr
prshksrvkgflrlkmaymp

SCOPe Domain Coordinates for d2nsqa_:

Click to download the PDB-style file with coordinates for d2nsqa_.
(The format of our PDB-style files is described here.)

Timeline for d2nsqa_: