SCOPe 2.03: Domain d2ns7c1: 2ns7 C:7-67

Lineage for d2ns7c1 (2ns7 C:7-67)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)

7. Species Escherichia coli [TaxId:562] [46766] (25 PDB entries)

8. Domain d2ns7c1: 2ns7 C:7-67 [205151]
   Other proteins in same PDB: d2ns7a2, d2ns7b2, d2ns7c2, d2ns7d2
   automated match to d1qpia1

Details for d2ns7c1

PDB Entry: 2ns7, 2.4 Å

PDB Description: how an in vitro selected peptide mimics the antibiotic tetracycline to induce tet repressor

PDB Compounds: (C:) Tetracycline repressor protein

SCOPe Domain Sequences for d2ns7c1:

Sequence; same for both SEQRES and ATOM records:

>d2ns7c1 a.4.1.9 (C:7-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
skvinsalellnevgieglttrklaqklgveqptlywhvknkralldalaiemldrhhth
f

Timeline for d2ns7c1:

• d2ns7c1 is new in SCOPe 2.03-stable
  
• d2ns7c1 appears in SCOPe 2.04
  
• d2ns7c1 appears in the current release, SCOPe 2.08