SCOPe 2.06: Domain d1qd0a_: 1qd0 A:

Lineage for d1qd0a_ (1qd0 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)

7. Species Llama (Lama glama) [TaxId:9844] [88565] (7 PDB entries)

8. Domain d1qd0a_: 1qd0 A: [20515]
   anti-RR6 VH domain
   complexed with cu, rr6

Details for d1qd0a_

PDB Entry: 1qd0, 2.5 Å

PDB Description: camelid heavy chain variable domains provide efficient combining sites to haptens

PDB Compounds: (A:) vhh-r2 anti-rr6 antibody

SCOPe Domain Sequences for d1qd0a_:

Sequence; same for both SEQRES and ATOM records:

>d1qd0a_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqaggslrlscaasgraasghghygmgwfrqvpgkerefvaairwsgke
twykdsvkgrftisrdnakttvylqmnslkgedtavyycaarpvrvadislpvgfdywgq
gtqvtvss

Timeline for d1qd0a_:

• d1qd0a_ first appeared (with stable ids) in SCOP 1.55
  
• d1qd0a_ appears in SCOPe 2.05
  
• d1qd0a_ is called d1qd0a1 in SCOPe 2.07
  
• d1qd0a_ appears in the current release, SCOPe 2.08, called d1qd0a1