Lineage for d1qd0a_ (1qd0 A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 220132Species Llama (Lama glama), anti-RR6 VH domain [48918] (1 PDB entry)
  8. 220133Domain d1qd0a_: 1qd0 A: [20515]
    complexed with cu, rr6

Details for d1qd0a_

PDB Entry: 1qd0 (more details), 2.5 Å

PDB Description: camelid heavy chain variable domains provide efficient combining sites to haptens

SCOP Domain Sequences for d1qd0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qd0a_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {Llama (Lama glama), anti-RR6 VH domain}
qvqlqesggglvqaggslrlscaasgraasghghygmgwfrqvpgkerefvaairwsgke
twykdsvkgrftisrdnakttvylqmnslkgedtavyycaarpvrvadislpvgfdywgq
gtqvtvss

SCOP Domain Coordinates for d1qd0a_:

Click to download the PDB-style file with coordinates for d1qd0a_.
(The format of our PDB-style files is described here.)

Timeline for d1qd0a_: