Lineage for d2ns7a2 (2ns7 A:68-206)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1279958Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 1279959Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 1279960Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 1280146Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species)
  7. 1280147Species Escherichia coli [TaxId:562] [48501] (25 PDB entries)
  8. 1280172Domain d2ns7a2: 2ns7 A:68-206 [205148]
    Other proteins in same PDB: d2ns7a1, d2ns7b1, d2ns7c1, d2ns7d1
    automated match to d1qpia2

Details for d2ns7a2

PDB Entry: 2ns7 (more details), 2.4 Å

PDB Description: how an in vitro selected peptide mimics the antibiotic tetracycline to induce tet repressor
PDB Compounds: (A:) Tetracycline repressor protein

SCOPe Domain Sequences for d2ns7a2:

Sequence, based on SEQRES records: (download)

>d2ns7a2 a.121.1.1 (A:68-206) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
splegeswqdflrnnaksfrnallshrdgakvhlgtrptekqyetlenqlafltqqgfsl
enalyalsavghftlgsvledqehqvakeeretpttdsmppllrqaielfdhqgaepafl
hgleslirgfevqltallq

Sequence, based on observed residues (ATOM records): (download)

>d2ns7a2 a.121.1.1 (A:68-206) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
splegeswqdflrnnaksfrnallshrdgakvhlgtrptekqyetlenqlafltqqgfsl
enalyalsavghftlgsvledqehqvakttdsmppllrqaielfdhqgaepaflhglesl
irgfevqltallq

SCOPe Domain Coordinates for d2ns7a2:

Click to download the PDB-style file with coordinates for d2ns7a2.
(The format of our PDB-style files is described here.)

Timeline for d2ns7a2: